PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.K01298.1.p
Common NameLOC105960941, MIMGU_mgv11b004965mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 460aa    MW: 50370.9 Da    PI: 9.9235
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.K01298.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.81.7e-31207263259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +DgynWrKYGqK+vk+se+prsYY+Ct+ +Cpvkkkve+s  d+ v++itY+g+Hnh+
  Migut.K01298.1.p 207 SDGYNWRKYGQKHVKNSECPRSYYKCTHLDCPVKKKVEKSL-DGAVLDITYKGQHNHD 263
                       6****************************************.***************7 PP

2WRKY106.81.1e-33346404159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYYrCt+agC+v+k+ver++ dpk+v++tYeg+Hnhe
  Migut.K01298.1.p 346 LDDGYKWRKYGQKVVKGNPHPRSYYRCTYAGCNVRKHVERASADPKAVVTTYEGKHNHE 404
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.9E-27201265IPR003657WRKY domain
SuperFamilySSF1182901.96E-24206265IPR003657WRKY domain
SMARTSM007743.2E-34206264IPR003657WRKY domain
PROSITE profilePS5081122.917207265IPR003657WRKY domain
PfamPF031062.6E-24208263IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.1E-36332406IPR003657WRKY domain
SuperFamilySSF1182901.03E-29338406IPR003657WRKY domain
PROSITE profilePS5081137.539341406IPR003657WRKY domain
SMARTSM007745.9E-40346405IPR003657WRKY domain
PfamPF031062.4E-26347404IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MGETAGDASP ATKPKPTILV PPRVPVGFLF ANGSGPGFSP GPMTLVSSLF PEQGPFSFSQ  60
LLAGAMASPN LLPTPISGKD GIFSANSKNS ERVVGQNSTR PISTAVAAPP GTLSPLFMVP  120
PGLSPSGYLS PLQSPFGMSH QQALAHVTAQ AALSQSFIQM QSQFHRSSST EAPTEKTLSK  180
KHDNQESSKI ELSEISQSGK RNDKRGSDGY NWRKYGQKHV KNSECPRSYY KCTHLDCPVK  240
KKVEKSLDGA VLDITYKGQH NHDIPTPNNK RAEKKTVLPS QGRIETDRAN DVVGDRSIVL  300
FDGGDDERVV KKRSLEIEAP VAASTHHQSV GEAKIVLQTR SEVDLLDDGY KWRKYGQKVV  360
KGNPHPRSYY RCTYAGCNVR KHVERASADP KAVVTTYEGK HNHEIPIGRY ISDESANRQL  420
PKTRKTVPKK PMPSKEMNYE KQEQNIPTTL HLKDEHITT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-37208406877Probable WRKY transcription factor 4
2lex_A3e-37208406877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012840610.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9XI901e-108WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A022R4T90.0A0A022R4T9_ERYGU; Uncharacterized protein
STRINGVIT_14s0108g01280.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43142344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-101WRKY DNA-binding protein 4